Discussion: Introduction to Histology Please answer each question in detail and picture is required and references I need high quality of work, AND remember this is a Histology paper so please make sure you include histology. It has to be 4 pages long 1: Describe in detail the different histological […]

What would happen to a patient’s cellular EK+ if a nurse accidentally administered a potassium solution that caused the patient’s extracellular potassium ion concentration to rise to 6.01 mM? Assume a body temperature of 37 °C. It would rise to -5.2 mV. It would have no effect on the EK+. […]

(a) develop a general mathematical relationship for the number of surface atoms (N_s), number of volume atoms (N_v), and total atoms (N_t) for cubic particles in terms of “n,” where n = number of atoms along a side of cubic nanoparticle. (b) How is Ns/Nt for cubic particles related to […]

Supplied below is a query amino acid sequence. Perform a BLAST Search Query Amino Acid Sequence. MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSâ?¦ Perform a search to find amino acid sequences of the database similar to the query amino acid sequence supplied[Hint: Select â??Standard Protein â?” protein BLAST [blastp]â? under the â??Protein BLAST â??option]Continue the search […]